Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113)

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD80 Mouse Monoclonal Antibody (RBITC)
orb1810554 100 µL

CD80 Mouse Monoclonal Antibody (RBITC)

Sign In for Pricing
View Details
TrkA Rabbit Polyclonal Antibody (AP)
orb911573 100 µL

TrkA Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Nipbl sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4529904 1.0 µg DNA

Nipbl sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
MUC2 (Mucin 2) (rMLP/842), CF568 conjugate, 0.1mg/mL
BNC683609-500 1x 500 µL

MUC2 (Mucin 2) (rMLP/842), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SF3B4P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
67390111 3x 1.0 µg

SF3B4P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Mucin 1 (MUC1)
MBS2042101-01 0.1 mL

HRP-Linked Polyclonal Antibody to Mucin 1 (MUC1)

Sign In for Pricing
View Details