Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RAD51-associated protein 2 (R51A2), partial

This Recombinant Human RAD51-associated protein 2 (R51A2), partial spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RAD51-associated protein 2 RAD51AP2

UniProt

Q09MP3

Expression Region

1-500

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSLPQPTPRMAELRKPTSSLTPPEDPDSQPPSSKRLCLEEPGGVFKAGWRLPLVPRLSEAEKVWELSPRPFKGLLVSTNAIFDNSTDSCVEKSVSGKQICNLKCSNLKFQMSSCLQSPPSQSPDSDLRASGRSEAGLHDREAFSVHRSNSSKAGVSQLLPSTSIHDIHGIRNENRKQQFVQGRDNVHKENPFLDVTFYKETKSPFHEIKNRCKANSVVPSNKRENNISSSVLKISKSQNQPSLEIAKPSYFRDSGTISVPQFPMDLNSKMSSVYLKEIAKKKNDKKEAYVRDFTNIYWSQNRPDVKKQKLQNDKKTVEAENIFSKCYENDYPSLSSQNTCKRKDLISSNYCNCSSIQCNVRDSRKNFAILENANWEEAECLDSYVLTRLEKSQNWDCNVRHILRRNRGNCWIINNCKTKCENMKKTEEKWNWLLLLEIDLLSKEDYHCAKVINAYEEQSKLLVREILGSQTALITTVWLNGKGENDNTLQLRYNTTQKVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF568 conjugate, 0.1mg/mL
BNC682130-500 1x 500 µL

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Phenyl-2-pyrrolidinone
TRC-P336740-500MG 500 mg

4-Phenyl-2-pyrrolidinone

Sign In for Pricing
View Details
c-Myc (MYC) Rabbit Polyclonal Antibody
TA378818 100 µL

c-Myc (MYC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat LAMP1/CD107a Protein (Fc Tag)
PKSR030304 100 µg

Recombinant Rat LAMP1/CD107a Protein (Fc Tag)

Sign In for Pricing
View Details
VPS41 Human Gene Knockout Kit (CRISPR)
KN207267 1 Kit

VPS41 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(Formylamino)-3-hydroxy-2-propenoic Acid Ethyl Ester
TRC-F695690-10MG 10 mg

2-(Formylamino)-3-hydroxy-2-propenoic Acid Ethyl Ester

Sign In for Pricing
View Details