Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 272 (TM272), partial

This Recombinant Human Transmembrane protein 272 (TM272), partial spans the amino acid sequence from region 73-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 272 TMEM272

UniProt

A0A1B0GTI8

Expression Region

73-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTOP3 Rabbit Polyclonal Antibody (Biotin)
orb450867 100 µL

OTOP3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PTPN4 Rabbit pAb
E45R25396N 50 ul

PTPN4 Rabbit pAb

Sign In for Pricing
View Details
Neuromedin U Antibody
E38PA4759 100 µL

Neuromedin U Antibody

Sign In for Pricing
View Details
Bovine Carcinoembryonic antigen related cell adhesion molecule 19 (CEACAM19) ELISA Kit
GTR10328486 96 Well

Bovine Carcinoembryonic antigen related cell adhesion molecule 19 (CEACAM19) ELISA Kit

Sign In for Pricing
View Details
E6 (NC_001583) Virus Tagged ORF Clone
VC101907 10 µg

E6 (NC_001583) Virus Tagged ORF Clone

Sign In for Pricing
View Details
TMCC1 sgRNA CRISPR Lentivector set (Human)
K2383801 3x 1.0 µg

TMCC1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details