Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 272 (TM272), partial

This Recombinant Human Transmembrane protein 272 (TM272), partial spans the amino acid sequence from region 73-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 272 TMEM272

UniProt

A0A1B0GTI8

Expression Region

73-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf117 3'UTR Luciferase Stable Cell Line
TU003286 1.0 mL

C21orf117 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Olfactory receptor 10S1 Polyclonal Antibody
UB-GEN-13249 100 µL

Olfactory receptor 10S1 Polyclonal Antibody

Sign In for Pricing
View Details
SF3B1 Antibody
49786-01 50 µL

SF3B1 Antibody

Sign In for Pricing
View Details
SF3B1 Antibody
49786-02 100 µL

SF3B1 Antibody

Sign In for Pricing
View Details
TEM1 CD248 Antibody PE Conjugated
C03948P 100 µL

TEM1 CD248 Antibody PE Conjugated

Sign In for Pricing
View Details
Recombinant Human Synaptic vesicle 2-related protein (SVOP), partial
MBS7095256 Inquire

Recombinant Human Synaptic vesicle 2-related protein (SVOP), partial

Sign In for Pricing
View Details