Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS18 siRNA (Human)
MBS8223833-01 15 nmol

RGS18 siRNA (Human)

Sign In for Pricing
View Details
RGS18 siRNA (Human)
MBS8223833-02 30 nmol

RGS18 siRNA (Human)

Sign In for Pricing
View Details
RGS18 siRNA (Human)
MBS8223833-03 5x 30 nmol

RGS18 siRNA (Human)

Sign In for Pricing
View Details
ZHX1 Rabbit Polyclonal Antibody (BF594)
orb2472217 100 µL

ZHX1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Rat Interleukin 2 (IL-2) ELISA Kit
NSL1402r 96 Tests

Rat Interleukin 2 (IL-2) ELISA Kit

Sign In for Pricing
View Details
Ficd (NM_001010946) Rat Tagged ORF Clone Lentiviral Particle
RR213421L3V 200 µL

Ficd (NM_001010946) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details