Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK1D (NM_153498) Human Recombinant Protein
TP307736L 1 mg

CAMK1D (NM_153498) Human Recombinant Protein

Sign In for Pricing
View Details
Indigo Carmine
TRC-I521353-25G 25 g

Indigo Carmine

Sign In for Pricing
View Details
Human TRPM4 activation kit by CRISPRa
GA110264 1 Kit

Human TRPM4 activation kit by CRISPRa

Sign In for Pricing
View Details
5-Bromo-2-chlorobenzaldehyde
TRC-B699463-250MG 250 mg

5-Bromo-2-chlorobenzaldehyde

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS705453 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Recombinant Human Persephin/PSPN Protein
PKSH033568-01 10 µg

Recombinant Human Persephin/PSPN Protein

Sign In for Pricing
View Details