Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Primer Panel
HPP6013C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
Accuris qMAX Probe One-Step RT-qPCR Kit, No Rox, 1000 reactions
PR2121-N-1000 1 Each

Accuris qMAX Probe One-Step RT-qPCR Kit, No Rox, 1000 reactions

Sign In for Pricing
View Details
HOXB8 Human Gene Knockout Kit (CRISPR)
KN421896 1 Kit

HOXB8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CD200R1 Protein (His Tag)
PKSM040801 100 µg

Recombinant Mouse CD200R1 Protein (His Tag)

Sign In for Pricing
View Details
Nonanal-d18
TRC-N649332-25MG 25 mg

Nonanal-d18

Sign In for Pricing
View Details
RENBP Human Gene Knockout Kit (CRISPR)
KN400697 1 Kit

RENBP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details