Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen I alpha2 antibody
MBS9403205-01 0.1 mL

Collagen I alpha2 antibody

Sign In for Pricing
View Details
Collagen I alpha2 antibody
MBS9403205-02 5x 0.1 mL

Collagen I alpha2 antibody

Sign In for Pricing
View Details
Elovl4 sgRNA CRISPR Lentivector set (Mouse)
K5031301 3x 1.0 µg

Elovl4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Homo sapiens (Human) SPNS1 Polyclonal Antibody
MBS9011823 Inquire

Rabbit anti-Homo sapiens (Human) SPNS1 Polyclonal Antibody

Sign In for Pricing
View Details
CDK9-IN-8
BA3816-1 1 mg

CDK9-IN-8

Sign In for Pricing
View Details
Lentiviral human MAP3K20 sgRNA gene knockout kit - Lentiviral human MAP3K20 sgRNA gene knockout kit (plasmid)
GTR15399098 1 Vial

Lentiviral human MAP3K20 sgRNA gene knockout kit - Lentiviral human MAP3K20 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details