Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myocilin opposite strand protein (MYCOS)

This Recombinant Human Myocilin opposite strand protein (MYCOS) spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myocilin opposite strand protein MYOCOS

UniProt

A0A1B0GUC4

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQKSLANNSINLPYKDLTSEVTRRRVTMITRKEIITQKSDEAKEMLSHLDLEQAPPPHRTYLTVPPAPPPSPAEDPTVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details