Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial

This Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial spans the amino acid sequence from region 27-74. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein GAFA-1; Gene associated with FGF-2 activity protein 1; GAFA1

UniProt

Q96PS6

Expression Region

27-74

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWSLTLSLRLECSSAIIKPTAASNSCVQVNLPPSMCDYRHEPLCLAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mettl3 Mouse qPCR Template Standard (NM_019721)
MK200629 1 Kit

Mettl3 Mouse qPCR Template Standard (NM_019721)

Sign In for Pricing
View Details
MORN1 Rabbit Polyclonal Antibody (HRP)
orb2089622 100 µL

MORN1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
KCNAB1 (KCNA1B) discontinued
510833 100 µg

KCNAB1 (KCNA1B) discontinued

Sign In for Pricing
View Details
Porcine Calcipressin 1 (RCAN1) ELISA Kit
GTR10367172 96 Well

Porcine Calcipressin 1 (RCAN1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human RPS23 shRNA (UAS) - Lentiviral human RPS23 shRNA (UAS, RFP) (25)
GTR15097187 1 Vial

Lentiviral human RPS23 shRNA (UAS) - Lentiviral human RPS23 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Cytochrome P450 1A2
orb1642777-01 50 µg

Cytochrome P450 1A2

Sign In for Pricing
View Details