Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial

This Recombinant Human Putative uncharacterized protein GAFA-1 (GAFA1), partial spans the amino acid sequence from region 27-74. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein GAFA-1; Gene associated with FGF-2 activity protein 1; GAFA1

UniProt

Q96PS6

Expression Region

27-74

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWSLTLSLRLECSSAIIKPTAASNSCVQVNLPPSMCDYRHEPLCLAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSDC2 antibody - N-terminal region
MBS3205465-01 0.1 mL

CSDC2 antibody - N-terminal region

Sign In for Pricing
View Details
CSDC2 antibody - N-terminal region
MBS3205465-02 5x 0.1 mL

CSDC2 antibody - N-terminal region

Sign In for Pricing
View Details
Rat Epidermal Growth Factor Receptor 2 (EGFR2) ELISA Kit
RD-EGFR2-Ra-01 96 Tests

Rat Epidermal Growth Factor Receptor 2 (EGFR2) ELISA Kit

Sign In for Pricing
View Details
Rat Epidermal Growth Factor Receptor 2 (EGFR2) ELISA Kit
RD-EGFR2-Ra-02 48 Tests

Rat Epidermal Growth Factor Receptor 2 (EGFR2) ELISA Kit

Sign In for Pricing
View Details
Anti-Sin3B antibody
STJ94263 200 µl

Anti-Sin3B antibody

Sign In for Pricing
View Details
Olr1201 siRNA Oligos set (Rat)
33741176 3x 5 nmol

Olr1201 siRNA Oligos set (Rat)

Sign In for Pricing
View Details