Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1), Biotinylated

This Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1), Biotinylated spans the amino acid sequence from region 1-400. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2'-5'-oligoadenylate synthase 1; (2-5'oligo (A; synthase 1; 2-5A synthase 1; EC 2.7.7.84; E18/E16; p46/p42 OAS; OAS1 OIAS

UniProt

P00973

Expression Region

1-400

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsr3 Mouse Gene Knockout Kit (CRISPR)
KN518375 1 Kit

Tsr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GSK3 alpha (GSK3A) Rabbit Polyclonal Antibody
AP02551PU-N 100 µL

GSK3 alpha (GSK3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF640R conjugate, 0.1mg/mL
BNC403635-500 1x 500 µL

Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgA1,  15nm
GM-105-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgA1, 15nm

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR562536 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
CaMKII alpha Antibody
KC-35854-01 50 μL

CaMKII alpha Antibody

Sign In for Pricing
View Details