Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1), Biotinylated

This Recombinant Human 2'-5'-oligoadenylate synthase 1 (OAS1), Biotinylated spans the amino acid sequence from region 1-400. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2'-5'-oligoadenylate synthase 1; (2-5'oligo (A; synthase 1; 2-5A synthase 1; EC 2.7.7.84; E18/E16; p46/p42 OAS; OAS1 OIAS

UniProt

P00973

Expression Region

1-400

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAP2B sgRNA CRISPR Lentivector (Human) (Target 2)
K1692903 1.0 µg DNA

PPAP2B sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
COOH-PEG-CH2CH2COOtBu, 2K
HE017067-2K Inquire

COOH-PEG-CH2CH2COOtBu, 2K

Sign In for Pricing
View Details
ABT1 Antibody
C42446-01 50 µL

ABT1 Antibody

Sign In for Pricing
View Details
ABT1 Antibody
C42446-02 100 µL

ABT1 Antibody

Sign In for Pricing
View Details
Rabbit Anti-PDE4C antibody
SL9962R-01 50 µL

Rabbit Anti-PDE4C antibody

Sign In for Pricing
View Details
Rabbit Anti-PDE4C antibody
SL9962R-02 100 µL

Rabbit Anti-PDE4C antibody

Sign In for Pricing
View Details