Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chorionic somatomammotropin hormone 1 (CSH1), Biotinylated

This Recombinant Human Chorionic somatomammotropin hormone 1 (CSH1), Biotinylated spans the amino acid sequence from region 27-217. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chorionic somatomammotropin hormone 1; Choriomammotropin; Lactogen; Placental lactogen; PL; CSH1

UniProt

P0DML2

Expression Region

27-217

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At3g18200 Polyclonal Antibody
MBS7146440 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At3g18200 Polyclonal Antibody

Sign In for Pricing
View Details
Hamster Speckle-Type Poz Protein ELISA Kit
MBS014079-01 48 Well

Hamster Speckle-Type Poz Protein ELISA Kit

Sign In for Pricing
View Details
Hamster Speckle-Type Poz Protein ELISA Kit
MBS014079-02 96 Well

Hamster Speckle-Type Poz Protein ELISA Kit

Sign In for Pricing
View Details
Hamster Speckle-Type Poz Protein ELISA Kit
MBS014079-03 5x 96 Well

Hamster Speckle-Type Poz Protein ELISA Kit

Sign In for Pricing
View Details
Hamster Speckle-Type Poz Protein ELISA Kit
MBS014079-04 10x 96 Well

Hamster Speckle-Type Poz Protein ELISA Kit

Sign In for Pricing
View Details
Rabbit Human Ig kappa light chain (free and bound), conjugated with TRITC Antibody
orb21520 1 mL

Rabbit Human Ig kappa light chain (free and bound), conjugated with TRITC Antibody

Sign In for Pricing
View Details