Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated

This Recombinant Human Spectrin beta chain, non-erythrocytic 1 (SPTB2), partial, Biotinylated spans the amino acid sequence from region 2197-2307. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Spectrin beta chain, non-erythrocytic 1; Beta-II spectrin; Fodrin beta chain; Spectrin, non-erythroid beta chain 1; SPTBN1 SPTB2

UniProt

Q01082

Expression Region

2197-2307

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP13 Lentiviral Activation Particles (h)
sc-406622-LAC 200 µL

USP13 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
NUP62CL Adenovirus (Mouse)
32338054 1.0 mL

NUP62CL Adenovirus (Mouse)

Sign In for Pricing
View Details
Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) Peptide
abx616089 100 µg

Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) Peptide

Sign In for Pricing
View Details
EPH Receptor A4 (EPHA4) Antibody (HRP)
abx315237-01 20 µg

EPH Receptor A4 (EPHA4) Antibody (HRP)

Sign In for Pricing
View Details
EPH Receptor A4 (EPHA4) Antibody (HRP)
abx315237-02 50 µg

EPH Receptor A4 (EPHA4) Antibody (HRP)

Sign In for Pricing
View Details
EPH Receptor A4 (EPHA4) Antibody (HRP)
abx315237-03 100 µg

EPH Receptor A4 (EPHA4) Antibody (HRP)

Sign In for Pricing
View Details