Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone-lysine N-methyltransferase MECOM (MECOM), partial, Biotinylated

This Recombinant Human Histone-lysine N-methyltransferase MECOM (MECOM), partial, Biotinylated spans the amino acid sequence from region 78-190. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone-lysine N-methyltransferase MECOM; EC 2.1.1.367; Ecotropic virus integration site 1 protein homolog; EVI-1; MDS1 and EVI1 complex locus protein; Myelodysplasia syndrome 1 protein; Myelodysplasia syndrome-associated protein 1; MECOM EVI1 MDS1 PRDM3

UniProt

Q03112

Expression Region

78-190

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin; Pharmacology & Drug Discovery; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit zeta-associated protein 70
GTR10433100 96 Well

Rabbit zeta-associated protein 70

Sign In for Pricing
View Details
Human Pro-Interleukin-16, IL16 Primacu ELISA Kit
MBS1612421-01 96 Well

Human Pro-Interleukin-16, IL16 Primacu ELISA Kit

Sign In for Pricing
View Details
Human Pro-Interleukin-16, IL16 Primacu ELISA Kit
MBS1612421-02 5x 96 Well

Human Pro-Interleukin-16, IL16 Primacu ELISA Kit

Sign In for Pricing
View Details
IL-4I1 CRISPR/Cas9 KO Plasmid (m)
sc-420354 20 µg

IL-4I1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human Paired box protein Pax-8 (PAX8)
CSB-EP017494HUc7-01 20 µg

Recombinant Human Paired box protein Pax-8 (PAX8)

Sign In for Pricing
View Details
Recombinant Human Paired box protein Pax-8 (PAX8)
CSB-EP017494HUc7-02 100 µg

Recombinant Human Paired box protein Pax-8 (PAX8)

Sign In for Pricing
View Details