Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 85 (ZNF85), Biotinylated

This Recombinant Human Zinc finger protein 85 (ZNF85), Biotinylated spans the amino acid sequence from region 1-595. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 85; Zinc finger protein HPF4; Zinc finger protein HTF1; ZNF85

UniProt

Q03923

Expression Region

1-595

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPTVMCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQCLTATQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHTRVNFYKCEECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNQSSNLIKHKKIHTGEKPYKCEECGKTFNRFSTLTTHKIIHTGEKPYKCKECGKAFNRSSTLTTHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKAFNQSAHLTTHEVIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTGEKPYKCKECGKAFKHSSTLTKHKIIHTGEKPYKCKECEKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKSHTEEKPYKCEECGKGFKWPSTLTIHKIIHTGEKPYKCEECGKAFNQSSKLTKHKKIHTGEKPYTCEECGKAFNQSSNLTKHKRIHTGEKPYKCEECDKAFKWSSVLTKHKIIHTGEKLQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio parahaemolyticus Translation initiation factor IF-2 (infB), partial
MBS1316106 Inquire

Recombinant Vibrio parahaemolyticus Translation initiation factor IF-2 (infB), partial

Sign In for Pricing
View Details
GSDME N-terminal  rabbit pAb
UB-GEN-12345 100 µL

GSDME N-terminal rabbit pAb

Sign In for Pricing
View Details
FAM124B Protein Vector (Human) (pPM-C-His)
PV015092 500 ng

FAM124B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Ubiquitin Rabbit pAb, BF700 conjugated
orb2849535 100 µL

Ubiquitin Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Lentiviral mouse 6430548M08Rik shRNA (UAS) - Lentiviral mouse 6430548M08Rik shRNA (UAS) (25)
GTR15158657 1 Vial

Lentiviral mouse 6430548M08Rik shRNA (UAS) - Lentiviral mouse 6430548M08Rik shRNA (UAS) (25)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 7 (CHRNa7)
MBS2064747-01 0.1 mL

APC-Linked Polyclonal Antibody to Cholinergic Receptor, Nicotinic, Alpha 7 (CHRNa7)

Sign In for Pricing
View Details