Recombinant Human Galectin-10 (LEG10), Biotinylated
This Recombinant Human Galectin-10 (LEG10), Biotinylated spans the amino acid sequence from region 2-142. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Galectin-10; Gal-10; Charcot-Leyden crystal protein; CLC; Eosinophil lysophospholipase; Lysolecithin acylhydrolase; CLC LGALS10 LGALS10A
UniProt
Q05315
Expression Region
2-142
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MSI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E9]](https://cdn.genprice.uk/products/937/6868c333994c49e6dc3f170e/imageurl/ta502254am.webp)
TA502254AM 100 µL
MSI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E9]
Sign In for Pricing
View Details 
BNUB1950-100 1x 100 µL
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), 0.2mg/mL
Sign In for Pricing
View Details 