Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pappalysin-1 (PAPP1), partial, Biotinylated

This Recombinant Human Pappalysin-1 (PAPP1), partial, Biotinylated spans the amino acid sequence from region 1476-1556. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pappalysin-1; EC 3.4.24.79; Insulin-like growth factor-dependent IGF-binding protein 4 protease; IGF-dependent IGFBP-4 protease; IGFBP-4ase; Pregnancy-associated plasma protein A; PAPP-A; PAPPA

UniProt

Q13219

Expression Region

1476-1556

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ribonuclease A8 (RNASE8) ELISA Kit
RD-RNASE8-Hu-01 96 Tests

Human Ribonuclease A8 (RNASE8) ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease A8 (RNASE8) ELISA Kit
RD-RNASE8-Hu-02 48 Tests

Human Ribonuclease A8 (RNASE8) ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), CF488A conjugate, 0.1mg/mL
BNC881190-100 1x 100 µL

Cytokeratin 18 (KRT18/1190), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL-1 beta Mouse Monoclonal Antibody [A7A10]
HA601035 100 µL

IL-1 beta Mouse Monoclonal Antibody [A7A10]

Sign In for Pricing
View Details
PYDC2 (NM_001083308) Human Over-expression Lysate
LY421211 100 µg

PYDC2 (NM_001083308) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Cox17 activation kit by CRISPRa
GA200837 1 Kit

Mouse Cox17 activation kit by CRISPRa

Sign In for Pricing
View Details