Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pappalysin-1 (PAPP1), partial, Biotinylated

This Recombinant Human Pappalysin-1 (PAPP1), partial, Biotinylated spans the amino acid sequence from region 1476-1556. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pappalysin-1; EC 3.4.24.79; Insulin-like growth factor-dependent IGF-binding protein 4 protease; IGF-dependent IGFBP-4 protease; IGFBP-4ase; Pregnancy-associated plasma protein A; PAPP-A; PAPPA

UniProt

Q13219

Expression Region

1476-1556

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Lung
CD564399 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714452 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
(6Z,9Z,26Z)-Pentatriaconta-6,9,26-trien-18-one
TRC-P284980-2.5MG 2.5 mg

(6Z,9Z,26Z)-Pentatriaconta-6,9,26-trien-18-one

Sign In for Pricing
View Details
Crude Limulus polyphemus Lectin (Horseshoe Crab) -LPA-
L-1500-1 1 mL

Crude Limulus polyphemus Lectin (Horseshoe Crab) -LPA-

Sign In for Pricing
View Details
TMEM208 Human Gene Knockout Kit (CRISPR)
KN400049 1 Kit

TMEM208 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NANP Rabbit Polyclonal Antibody
TA370793 100 µL

NANP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details