Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pappalysin-1 (PAPP1), partial, Biotinylated

This Recombinant Human Pappalysin-1 (PAPP1), partial, Biotinylated spans the amino acid sequence from region 1476-1556. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pappalysin-1; EC 3.4.24.79; Insulin-like growth factor-dependent IGF-binding protein 4 protease; IGF-dependent IGFBP-4 protease; IGFBP-4ase; Pregnancy-associated plasma protein A; PAPP-A; PAPPA

UniProt

Q13219

Expression Region

1476-1556

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGN2P41 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV763289 1.0 µg DNA

HMGN2P41 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PLSCR3 Rabbit Monoclonal Antibody
E56G4938 100 µL

PLSCR3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ZNF323 (ZSCAN31) Human qPCR Primer Pair (NM_030899)
HP215451 200 Reactions

ZNF323 (ZSCAN31) Human qPCR Primer Pair (NM_030899)

Sign In for Pricing
View Details
SLIRP Rabbit Polyclonal Antibody
orb2985520 100 µg

SLIRP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant (E. coli) Borrelia garinii OspA protein (OSP-A, 95%, His-tag) for ELISA
OSPA57-R-10 10 µg

Recombinant (E. coli) Borrelia garinii OspA protein (OSP-A, 95%, His-tag) for ELISA

Sign In for Pricing
View Details
7-Bromo-2-chloroquinazoline
439445-01 25 mg

7-Bromo-2-chloroquinazoline

Sign In for Pricing
View Details