Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PAT complex subunit Asterix (ASTER), partial, Biotinylated

This Recombinant Human PAT complex subunit Asterix (ASTER), partial, Biotinylated spans the amino acid sequence from region 2-32. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAT complex subunit Asterix; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10; WD repeat domain 83 opposite strand; WDR83 opposite strand; WDR83OS C19orf56 CGI-140 My006 PTD008

UniProt

Q9Y284

Expression Region

2-32

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STNNMSDPRRPNKVLRYKPPPSECNPALDDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O,O-Di-2-Naphthalenyl Ester Carbonothioic Acid
TRC-D479930-250MG 250 mg

O,O-Di-2-Naphthalenyl Ester Carbonothioic Acid

Sign In for Pricing
View Details
Lentiviral mouse Sec62 shRNA (UAS) - Lentiviral mouse Sec62 shRNA (UAS) (100)
GTR15216702 1 Vial

Lentiviral mouse Sec62 shRNA (UAS) - Lentiviral mouse Sec62 shRNA (UAS) (100)

Sign In for Pricing
View Details
Kcnj11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3887805 3x 1.0 µg

Kcnj11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CBX8 (D2O8C) Rabbit Monoclonal Antibody
CST 14696S 100 µL

CBX8 (D2O8C) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HBA1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb912876 100 µL

HBA1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Anti-Hu CD14 PE
1P-212-T100 100 Tests

Anti-Hu CD14 PE

Sign In for Pricing
View Details