Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PAT complex subunit Asterix (ASTER), partial, Biotinylated

This Recombinant Human PAT complex subunit Asterix (ASTER), partial, Biotinylated spans the amino acid sequence from region 2-32. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAT complex subunit Asterix; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10; WD repeat domain 83 opposite strand; WDR83 opposite strand; WDR83OS C19orf56 CGI-140 My006 PTD008

UniProt

Q9Y284

Expression Region

2-32

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

STNNMSDPRRPNKVLRYKPPPSECNPALDDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF93 Rabbit Polyclonal Antibody (PerCP)
orb2378876 100 µL

RNF93 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
TRIM32 CRISPR/Cas9 KO Plasmid (h)
sc-402731 20 µg

TRIM32 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human APOBEC3B sgRNA gene knockout kit - Lentiviral human APOBEC3B sgRNA gene knockout kit (100)
GTR15366076 1 Vial

Lentiviral human APOBEC3B sgRNA gene knockout kit - Lentiviral human APOBEC3B sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
THEMIS Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-12329R-BF594 100 µL

THEMIS Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Anti-CTCF Antibody Picoband® (Dylight594 Conjugate)
PB9493-Dylight594 100 µg

Anti-CTCF Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
MYH9 Protein (N-His, Mus musculus (Mouse) )
P506341 100 µg

MYH9 Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details