Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial, Biotinylated

This Recombinant Human Syntaxin-binding protein 5-like (STB5L), partial, Biotinylated spans the amino acid sequence from region 1121-1181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Syntaxin-binding protein 5-like; Lethal (2; giant larvae protein homolog 4; Tomosyn-2; STXBP5L KIAA1006 LLGL4

UniProt

Q9Y2K9

Expression Region

1121-1181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SIEGMKGAAGGVMGELTRARIALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mir220 Mouse qPCR Primer Pair (MI0005487)
MP300207 200 Reactions

Mir220 Mouse qPCR Primer Pair (MI0005487)

Sign In for Pricing
View Details
ABAT (4-Aminobutyrate Aminotransferase, Mitochondrial, 4-Aminobutyrate Aminotransferase)
474444 100 µL

ABAT (4-Aminobutyrate Aminotransferase, Mitochondrial, 4-Aminobutyrate Aminotransferase)

Sign In for Pricing
View Details
Gynostemma Extract
C08441-10mg 10 mg

Gynostemma Extract

Sign In for Pricing
View Details
MRPL2 Antibody
CSB-PA735972LA01HU-01 50 µg

MRPL2 Antibody

Sign In for Pricing
View Details
MRPL2 Antibody
CSB-PA735972LA01HU-02 100 µg

MRPL2 Antibody

Sign In for Pricing
View Details
Lentiviral human TNNI2 shRNA (UAS) - Lentiviral human TNNI2 shRNA (UAS) (25)
GTR15352952 1 Vial

Lentiviral human TNNI2 shRNA (UAS) - Lentiviral human TNNI2 shRNA (UAS) (25)

Sign In for Pricing
View Details