Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Unconventional myosin-Va (MYO5A), partial, Biotinylated

This Recombinant Human Unconventional myosin-Va (MYO5A), partial, Biotinylated spans the amino acid sequence from region 69-763. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Unconventional myosin-Va; Dilute myosin heavy chain, non-muscle; Myosin heavy chain 12; Myosin-12; Myoxin; MYO5A MYH12

UniProt

Q9Y4I1

Expression Region

69-763

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLGNADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIFCELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSANTD2 Recombinant Protein Antigen
NBP2-38427PEP 0.1 mL

MSANTD2 Recombinant Protein Antigen

Sign In for Pricing
View Details
1-Hexyl-3-methylimidazolium bromide
IL-0069-HP-0500 500 g

1-Hexyl-3-methylimidazolium bromide

Sign In for Pricing
View Details
Anti-PPP1R13L Antibody (N-Term)
M03058-400ul 400 µL

Anti-PPP1R13L Antibody (N-Term)

Sign In for Pricing
View Details
Efnb2 3'UTR GFP Stable Cell Line
TU253823 1.0 mL

Efnb2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ybx2 3'UTR GFP Stable Cell Line
TU172416 1.0 mL

Ybx2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ETS1 Rabbit Polyclonal Antibody (Fluoro594)
orb3116202 100 µg

ETS1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details