Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial, Biotinylated

This Recombinant Human Claudin-16 (CLD16), partial, Biotinylated spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS8P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV782651 1.0 µg DNA

RPS8P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CCL4/MIP-1 beta ELISA Kit (Rat) (OKBB00467)
OKBB00467 96 Well

CCL4/MIP-1 beta ELISA Kit (Rat) (OKBB00467)

Sign In for Pricing
View Details
GNB5 Human Over-expression Lysate
orb1369135 20 µg

GNB5 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap)
MBS1177084-01 0.02 mg (E-Coli)

Recombinant Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap)

Sign In for Pricing
View Details
Recombinant Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap)
MBS1177084-02 0.1 mg (E-Coli)

Recombinant Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap)

Sign In for Pricing
View Details
Recombinant Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap)
MBS1177084-03 0.02 mg (Yeast)

Recombinant Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap)

Sign In for Pricing
View Details