Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial, Biotinylated

This Recombinant Human Claudin-16 (CLD16), partial, Biotinylated spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MDM2/HDM2 Antibody (SMP14) [Alexa Fluor 594]
NB100-2736AF594 0.1 mL

Mouse Monoclonal MDM2/HDM2 Antibody (SMP14) [Alexa Fluor 594]

Sign In for Pricing
View Details
Human Fetuin A ELISA Kit
CEK1149 96 Tests

Human Fetuin A ELISA Kit

Sign In for Pricing
View Details
Pcyt1a Mouse shRNA Lentiviral Particle (Locus ID 13026)
TL510372V 500 µL Each

Pcyt1a Mouse shRNA Lentiviral Particle (Locus ID 13026)

Sign In for Pricing
View Details
Recombinant Dog C-C motif chemokine 17 (CCL17), Biotinylated
CSB-EP856825DO-B-01 20 µg

Recombinant Dog C-C motif chemokine 17 (CCL17), Biotinylated

Sign In for Pricing
View Details
Recombinant Dog C-C motif chemokine 17 (CCL17), Biotinylated
CSB-EP856825DO-B-02 100 µg

Recombinant Dog C-C motif chemokine 17 (CCL17), Biotinylated

Sign In for Pricing
View Details
Recombinant Dog C-C motif chemokine 17 (CCL17), Biotinylated
CSB-EP856825DO-B-03 1 mg

Recombinant Dog C-C motif chemokine 17 (CCL17), Biotinylated

Sign In for Pricing
View Details