Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-5 (TVB65), Biotinylated

This Recombinant Human T cell receptor beta variable 6-5 (TVB65), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-5 TRBV6-5

UniProt

A0A0K0K1A5

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Endometriotic tissue
CB502542 1 Block

Frozen Tissue Blocks, Endometriotic tissue

Sign In for Pricing
View Details
Unc13b Mouse Gene Knockout Kit (CRISPR)
KN518701 1 Kit

Unc13b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASPG (NM_001080464) Human Recombinant Protein
TP318090L 1 mg

ASPG (NM_001080464) Human Recombinant Protein

Sign In for Pricing
View Details
4-Nitrophenethyl Bromide
TRC-N545090-5G 5 g

4-Nitrophenethyl Bromide

Sign In for Pricing
View Details
Recombinant TBL1X Antibody
RN-13749-01 50 μL

Recombinant TBL1X Antibody

Sign In for Pricing
View Details
Recombinant TBL1X Antibody
RN-13749-02 100 µL

Recombinant TBL1X Antibody

Sign In for Pricing
View Details