Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human C3AR1 (Complement C3a receptor 1) Full Length
MPC0041K Each

Magic™ Membrane Protein Human C3AR1 (Complement C3a receptor 1) Full Length

Sign In for Pricing
View Details
Anti-Hu CD13 APC
1A-396-T025 25 Tests

Anti-Hu CD13 APC

Sign In for Pricing
View Details
Lin28B (1R14) Rabbit Monoclonal Antibody
E28M3768 100 µL

Lin28B (1R14) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CLPTM1L (NM_030782) Human Tagged Lenti ORF Clone
RC206866L3 10 µg

CLPTM1L (NM_030782) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NDUFS6 (B-5) Alexa Fluor® 790
sc-518214 AF790 200 µg/mL

NDUFS6 (B-5) Alexa Fluor® 790

Sign In for Pricing
View Details
LHX9 siRNA (m)
sc-38720 10 µM

LHX9 siRNA (m)

Sign In for Pricing
View Details