Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1qtnf7 (NM_175425) Mouse Untagged Clone
MC212203 10 µg

C1qtnf7 (NM_175425) Mouse Untagged Clone

Sign In for Pricing
View Details
SERCA1 (Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 1, ATP2A1, SR Ca (2+) -ATPase 1, Calcium Pump 1, Calcium-transporting ATPase Sarcoplasmic Reticulum Type, Fast Twitch Skeletal Muscle Isoform, Endoplasmic Reticulum Class 1/2 Ca (2+) ATPase)
133147 100 µg

SERCA1 (Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 1, ATP2A1, SR Ca (2+) -ATPase 1, Calcium Pump 1, Calcium-transporting ATPase Sarcoplasmic Reticulum Type, Fast Twitch Skeletal Muscle Isoform, Endoplasmic Reticulum Class 1/2 Ca (2+) ATPase)

Sign In for Pricing
View Details
SH3BGR Rabbit Polyclonal Antibody (Biotin)
orb452589 100 µL

SH3BGR Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
TWSG1 Conjugated Antibody
orb1617302 100 µL

TWSG1 Conjugated Antibody

Sign In for Pricing
View Details
1,3,5-Tris (Terphenyl) -Benzene
OR1009155-01 100 mg

1,3,5-Tris (Terphenyl) -Benzene

Sign In for Pricing
View Details
1,3,5-Tris (Terphenyl) -Benzene
OR1009155-02 1 g

1,3,5-Tris (Terphenyl) -Benzene

Sign In for Pricing
View Details