Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-27 (KV127), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-27 (KV127), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-27 IGKV1-27

UniProt

A0A075B6S5

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD34 Antibody (4H11[APG]) [Biotin]
NB500-608B 0.1 mL

Mouse Monoclonal CD34 Antibody (4H11[APG]) [Biotin]

Sign In for Pricing
View Details
SIRT7 (NM_016538) Human Tagged ORF Clone Lentiviral Particle
RC205658L4V 200 µL

SIRT7 (NM_016538) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human HERPUD2 activation kit by CRISPRa
GA112022 1 Kit

Human HERPUD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-p67 Antibody
CPA4842-01 30 µL

Anti-p67 Antibody

Sign In for Pricing
View Details
Anti-p67 Antibody
CPA4842-02 50 μL

Anti-p67 Antibody

Sign In for Pricing
View Details
Anti-p67 Antibody
CPA4842-03 100 µL

Anti-p67 Antibody

Sign In for Pricing
View Details