Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-40 (KV240), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2-40 (KV240), Biotinylated spans the amino acid sequence from region 20-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-40 IGKV2-40

UniProt

A0A087WW87

Expression Region

20-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chmp2a-set siRNA/shRNA/RNAi Lentivector (Rat)
16083096 4x 500 ng

Chmp2a-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal KNOP1 Antibody
NBP2-55695 100 µL

Rabbit Polyclonal KNOP1 Antibody

Sign In for Pricing
View Details
Atto Rho12 1 umol scale
26-6967-01 1 Each

Atto Rho12 1 umol scale

Sign In for Pricing
View Details
PHF16 Antibody (C-term)
orb164431-01 50 µL

PHF16 Antibody (C-term)

Sign In for Pricing
View Details
PHF16 Antibody (C-term)
orb164431-02 100 µL

PHF16 Antibody (C-term)

Sign In for Pricing
View Details
P-NH2-Bn-NOTA (hydrochloride hydrate)
HY-158066-01 5 mg

P-NH2-Bn-NOTA (hydrochloride hydrate)

Sign In for Pricing
View Details