Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1), Biotinylated

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1), Biotinylated spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Nucleoside diphosphokinase A (NME1) ELISA Kit
NSL1194Hu 96 Tests

Human Nucleoside diphosphokinase A (NME1) ELISA Kit

Sign In for Pricing
View Details
VCAM1 Rabbit Polyclonal Antibody (Biotin)
orb2612752 100 µg

VCAM1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Ankrd2-set siRNA/shRNA/RNAi Lentivector (Mouse)
11945094 4x 500 ng

Ankrd2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
GAGE4 3'UTR Luciferase Stable Cell Line
TU008492 1.0 mL

GAGE4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal TTF2 Antibody [Alexa Fluor 488]
NBP2-97769AF488 0.1 mL

Rabbit Polyclonal TTF2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
PcDNA3.1 (+) -3*HA-ERCC6
PPL01881-2a 1 Each

PcDNA3.1 (+) -3*HA-ERCC6

Sign In for Pricing
View Details