Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1), Biotinylated

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1), Biotinylated spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal VSTM5 Antibody (2696A) [Alexa Fluor 532]
FAB10872X 0.1 mL

Rabbit Monoclonal VSTM5 Antibody (2696A) [Alexa Fluor 532]

Sign In for Pricing
View Details
PRMT1 isoform 3 protein (MBP tag)
80R-1042 100 ug

PRMT1 isoform 3 protein (MBP tag)

Sign In for Pricing
View Details
DBF4 Antibody, HRP conjugated
A70532-100UG 100 µg

DBF4 Antibody, HRP conjugated

Sign In for Pricing
View Details
RFX7 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38885156 3x 1.0 µg DNA

RFX7 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Human FAM151A Protein, His (Fc)-Avi-tagged
FAM151A-887H 50 µg

Recombinant Human FAM151A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Human Superoxide dismutase [Mn], mitochondrial Protein
orb1475776-01 50 µg

Human Superoxide dismutase [Mn], mitochondrial Protein

Sign In for Pricing
View Details