Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1), Biotinylated

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1), Biotinylated spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLTA 293 Cell Lysate
407586 0.1 mg

CLTA 293 Cell Lysate

Sign In for Pricing
View Details
L2 (NC_001405) Virus Tagged ORF Clone
VC100380 10 µg

L2 (NC_001405) Virus Tagged ORF Clone

Sign In for Pricing
View Details
ALPG Polyclonal Antibody
ANT-10181-100ug 100 µg

ALPG Polyclonal Antibody

Sign In for Pricing
View Details
8-Bromoisoquinoline
440051-01 1 g

8-Bromoisoquinoline

Sign In for Pricing
View Details
8-Bromoisoquinoline
440051-02 5 g

8-Bromoisoquinoline

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Sensor protein kinase walK (walK)
orb2923202-01 20 µg

Recombinant Staphylococcus aureus Sensor protein kinase walK (walK)

Sign In for Pricing
View Details