Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-8 (TVB68), Biotinylated

This Recombinant Human T cell receptor beta variable 6-8 (TVB68), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-8 TRBV6-8

UniProt

A0A0A6YYG3

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYLCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium/Calmodulin Dependent Protein Kinase II - g (345 - 358)
orb2694812-01 5 mg

Calcium/Calmodulin Dependent Protein Kinase II - g (345 - 358)

Sign In for Pricing
View Details
Calcium/Calmodulin Dependent Protein Kinase II - g (345 - 358)
orb2694812-02 10 mg

Calcium/Calmodulin Dependent Protein Kinase II - g (345 - 358)

Sign In for Pricing
View Details
Fetuin A/AHSG Recombinant Antibody, FITC Conjugated
bsm-62392R-FITC 100 µL

Fetuin A/AHSG Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
SOD1
pro-648 5µg

SOD1

Sign In for Pricing
View Details
PSD3, Control Peptide (HCA67, PH and SEC7 Domain-containing Protein 3, Exchange Factor for ADP-ribosylation Factor Guanine Nucleotide Factor 6, Hepatocellular Carcinoma-associated Antigen 67, Pleckstrin Homology and SEC7 Domain-containing Protein 3, EFA6R, KIAA0942, DKFZp761K1423)
148379 100 µg

PSD3, Control Peptide (HCA67, PH and SEC7 Domain-containing Protein 3, Exchange Factor for ADP-ribosylation Factor Guanine Nucleotide Factor 6, Hepatocellular Carcinoma-associated Antigen 67, Pleckstrin Homology and SEC7 Domain-containing Protein 3, EFA6R, KIAA0942, DKFZp761K1423)

Sign In for Pricing
View Details
RELB Mouse mAb
E2220972 100 µL

RELB Mouse mAb

Sign In for Pricing
View Details