Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-21 (HV321), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-21 (HV321), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-21 IGHV3-21

UniProt

A0A0B4J1V1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Canine FGF4 ELISA Kit
GR115186 96 Well

Nori® Canine FGF4 ELISA Kit

Sign In for Pricing
View Details
BSTFA Containing 1% TMCS
B8811-01 25 mL

BSTFA Containing 1% TMCS

Sign In for Pricing
View Details
BSTFA Containing 1% TMCS
B8811-02 100 mL

BSTFA Containing 1% TMCS

Sign In for Pricing
View Details
CEACAM16 Peptide
DF9343-BP 1 mg

CEACAM16 Peptide

Sign In for Pricing
View Details
CCL19 Antibody
OACD05606-1ML 1 mL

CCL19 Antibody

Sign In for Pricing
View Details
Pds1 (BSA & Azide Free) (PE)
MBS6267042-01 0.1 mL

Pds1 (BSA & Azide Free) (PE)

Sign In for Pricing
View Details