Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-2 (TVA82), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-2 (TVA82), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-2 TRAV8-2

UniProt

A0A0B4J237

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPA1 (Magnesium Transporter NIPA1, Non Imprinted in Prader-Willi/Angelman Syndrome 1)
486888 100 µL

NIPA1 (Magnesium Transporter NIPA1, Non Imprinted in Prader-Willi/Angelman Syndrome 1)

Sign In for Pricing
View Details
BATF3 AAV siRNA Pooled Vector
13025161 1.0 µg

BATF3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ARTS1 Rabbit pAb, AE conjugated
orb2848361 100 µL

ARTS1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Anti-Exo70/EXOC7 Antibody Picoband® Fluoro594 Conjugated
A07926-3-Fluoro594 100 µg/Vial

Anti-Exo70/EXOC7 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
PDE3B Rabbit Polyclonal Antibody (Biotin)
orb2119345 100 µL

PDE3B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Olfr837 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
33486124 3x 1.0µg DNA

Olfr837 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details