Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2), Biotinylated

This Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-2 TRAV26-2

UniProt

A0A0B4J265

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tdpoz2 (NM_001007222) Mouse Tagged ORF Clone
MG216139 10 µg

Tdpoz2 (NM_001007222) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal ADP-Sugar Pyrophosphatase/NUDT5 Antibody [DyLight 680]
NBP3-00064FR 0.1 mL

Rabbit Polyclonal ADP-Sugar Pyrophosphatase/NUDT5 Antibody [DyLight 680]

Sign In for Pricing
View Details
CSN7a Double Nickase Plasmid (h)
sc-408503-NIC 20 µg

CSN7a Double Nickase Plasmid (h)

Sign In for Pricing
View Details
IGFBP5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
24325066 1.0 µg DNA

IGFBP5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Porcine GLP-1 (Glucagon-like peptide-1) ELISA Kit
MBS7606277-01 48 Strip Well

Porcine GLP-1 (Glucagon-like peptide-1) ELISA Kit

Sign In for Pricing
View Details
Porcine GLP-1 (Glucagon-like peptide-1) ELISA Kit
MBS7606277-02 96 Strip Well

Porcine GLP-1 (Glucagon-like peptide-1) ELISA Kit

Sign In for Pricing
View Details