Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2), Biotinylated

This Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-2 TRAV26-2

UniProt

A0A0B4J265

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gcnt3 (NM_173312) Rat Tagged ORF Clone Lentiviral Particle
RR213431L4V 200 µL

Gcnt3 (NM_173312) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Micall2 activation kit by CRISPRa
GA214297 1 Kit

Mouse Micall2 activation kit by CRISPRa

Sign In for Pricing
View Details
FOXO3 3'UTR Luciferase Stable Cell Line
TU008132 1.0 mL

FOXO3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
H-Asp (OtBu) -OMe · HCl
4004029.0001 1 g

H-Asp (OtBu) -OMe · HCl

Sign In for Pricing
View Details
Lentiviral human TULP2 shRNA (UAS) - Lentiviral human TULP2 shRNA (UAS, iRFP) (100)
GTR15093819 1 Vial

Lentiviral human TULP2 shRNA (UAS) - Lentiviral human TULP2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Galeterone
C17078-200mg 200 mg

Galeterone

Sign In for Pricing
View Details