Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated

This Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankzf1 Rat shRNA Plasmid (Locus ID 363255)
TR702338 1 Kit

Ankzf1 Rat shRNA Plasmid (Locus ID 363255)

Sign In for Pricing
View Details
RPL23AP46 Adenovirus (Human)
41171051 1.0 mL

RPL23AP46 Adenovirus (Human)

Sign In for Pricing
View Details
TOPK Antibody
E38QA7710 100 µL

TOPK Antibody

Sign In for Pricing
View Details
NBPF5 Rabbit Polyclonal Antibody (BF647)
orb2473662 100 µL

NBPF5 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Fam60a (NM_019643) Mouse Tagged ORF Clone
MR202537 10 µg

Fam60a (NM_019643) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SLPI Protein Lysate (Mouse) with C-HA Tag
44379034 100 µg

SLPI Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details