Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated

This Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Acute Myeloid Leukemia Cells [KG-1a]
AFG-ELL-0031 > 1x 10^6 Cells / Vial

Human Acute Myeloid Leukemia Cells [KG-1a]

Sign In for Pricing
View Details
CENP-T (h) -PR
sc-93326-PR 10 µM - 20 µL

CENP-T (h) -PR

Sign In for Pricing
View Details
Rabbit Polyclonal to Human PDCD1 / CD279 / PD-1
MBS240383-01 0.05 mg

Rabbit Polyclonal to Human PDCD1 / CD279 / PD-1

Sign In for Pricing
View Details
Rabbit Polyclonal to Human PDCD1 / CD279 / PD-1
MBS240383-02 5x 0.05 mg

Rabbit Polyclonal to Human PDCD1 / CD279 / PD-1

Sign In for Pricing
View Details
SelU Antibody
orb832108 2 mg

SelU Antibody

Sign In for Pricing
View Details
Quick Step Rat Pasteurella multocida antibody (PTM- Ab) elisa Kit
QS1385Ra-01 48 Tests

Quick Step Rat Pasteurella multocida antibody (PTM- Ab) elisa Kit

Sign In for Pricing
View Details