Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated

This Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf34 3'UTR Lenti-reporter-Luc Vector
14033081 1.0 µg

C18orf34 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human IL21R Pre-designed siRNA Set A
SI007595A 1 Each

Human IL21R Pre-designed siRNA Set A

Sign In for Pricing
View Details
KITLG siRNA (Human)
CRH2892-01 15 nmol

KITLG siRNA (Human)

Sign In for Pricing
View Details
KITLG siRNA (Human)
CRH2892-02 30 nmol

KITLG siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal ATP2C1 Antibody [Alexa Fluor 532]
NBP1-76566AF532 0.1 mL

Rabbit Polyclonal ATP2C1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Human VEGF206 (Vascular Endothelial Growth Factor 206) ELISA Kit
EK246901 96 Well

Human VEGF206 (Vascular Endothelial Growth Factor 206) ELISA Kit

Sign In for Pricing
View Details