Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-18 (HV118), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-18 (HV118), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-18 IGHV1-18

UniProt

A0A0C4DH31

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Azabicyclo[3.3.0]octane Hydrochloride
TRC-A795340-1G 1 g

3-Azabicyclo[3.3.0]octane Hydrochloride

Sign In for Pricing
View Details
THAP4 Antibody
8C19099-AAT 50 µg

THAP4 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703037 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
TAG72 Mouse Monoclonal Antibody [Clone ID: CC49]
AM33303PU-T 20 µg

TAG72 Mouse Monoclonal Antibody [Clone ID: CC49]

Sign In for Pricing
View Details
PAR6 Antibody
KC-37098-01 50 μL

PAR6 Antibody

Sign In for Pricing
View Details
PAR6 Antibody
KC-37098-02 100 µL

PAR6 Antibody

Sign In for Pricing
View Details