Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-4 (TVB74), Biotinylated

This Recombinant Human T cell receptor beta variable 7-4 (TVB74), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-4 TRBV7-4

UniProt

A0A1B0GX95

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYSQSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX5 Colorimetric Cell-Based ELISA Kit (OKAG01244)
OKAG01244 96 Well

CBX5 Colorimetric Cell-Based ELISA Kit (OKAG01244)

Sign In for Pricing
View Details
Synomag®-D COOH
104-02-501 5 mL

Synomag®-D COOH

Sign In for Pricing
View Details
Anti-CD44 Antibody Picoband®, Dylight550 Conjugate
A00052-2-Dylight550 100 µg

Anti-CD44 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
ZNF397 (Zinc Finger Protein 397, Zinc Finger and SCAN Domain-containing Protein 15, ZSCAN15, Zinc Finger Protein 47, ZNF47) (AP) discontinued
135723-AP 100 µL

ZNF397 (Zinc Finger Protein 397, Zinc Finger and SCAN Domain-containing Protein 15, ZSCAN15, Zinc Finger Protein 47, ZNF47) (AP) discontinued

Sign In for Pricing
View Details
A, a-D-Trehalose anhydrous
OT03932-01 0.25 kg

A, a-D-Trehalose anhydrous

Sign In for Pricing
View Details
A, a-D-Trehalose anhydrous
OT03932-02 0.5 Kg

A, a-D-Trehalose anhydrous

Sign In for Pricing
View Details