Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-6 (TVB56), Biotinylated

This Recombinant Human T cell receptor beta variable 5-6 (TVB56), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-6 TRBV5-6 TCRBV5S2

UniProt

A0A599

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snapc5 (NM_001109643) Rat Tagged ORF Clone
RR206633 10 µg

Snapc5 (NM_001109643) Rat Tagged ORF Clone

Sign In for Pricing
View Details
ITK, ID
501895 200 µL

ITK, ID

Sign In for Pricing
View Details
Canine Distemper Virus / Canine Parainfluenza Virus Real Time PCR Detection Kit
GZP079 8 Tests/Kit

Canine Distemper Virus / Canine Parainfluenza Virus Real Time PCR Detection Kit

Sign In for Pricing
View Details
Y-27632 dihydrochloride
T1725-01 5 mg

Y-27632 dihydrochloride

Sign In for Pricing
View Details
Y-27632 dihydrochloride
T1725-02 1 mL - 10 mM (in DMSO)

Y-27632 dihydrochloride

Sign In for Pricing
View Details
Y-27632 dihydrochloride
T1725-03 10 mg

Y-27632 dihydrochloride

Sign In for Pricing
View Details