Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-6 (TVB56), Biotinylated

This Recombinant Human T cell receptor beta variable 5-6 (TVB56), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-6 TRBV5-6 TCRBV5S2

UniProt

A0A599

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPPRC Antibody - N-terminal region (ARP41093_P050)
ARP41093_P050 100 µL

LPPRC Antibody - N-terminal region (ARP41093_P050)

Sign In for Pricing
View Details
TIMP1, NT (Metalloproteinase Inhibitor 1, Tissue Inhibitor Of Metalloproteinases 1, TIMP-1, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor, Collagenase Inhibitor, TIMP, CLGI) (HRP) discontinued
T5580-08B-HRP 200 µL

TIMP1, NT (Metalloproteinase Inhibitor 1, Tissue Inhibitor Of Metalloproteinases 1, TIMP-1, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor, Collagenase Inhibitor, TIMP, CLGI) (HRP) discontinued

Sign In for Pricing
View Details
Polyclonal Antibody to F-Box And WD Repeat Domain Containing Protein 7 (FBXW7)
MBS2026101-01 0.1 mL

Polyclonal Antibody to F-Box And WD Repeat Domain Containing Protein 7 (FBXW7)

Sign In for Pricing
View Details
Polyclonal Antibody to F-Box And WD Repeat Domain Containing Protein 7 (FBXW7)
MBS2026101-02 0.2 mL

Polyclonal Antibody to F-Box And WD Repeat Domain Containing Protein 7 (FBXW7)

Sign In for Pricing
View Details
Polyclonal Antibody to F-Box And WD Repeat Domain Containing Protein 7 (FBXW7)
MBS2026101-03 0.5 mL

Polyclonal Antibody to F-Box And WD Repeat Domain Containing Protein 7 (FBXW7)

Sign In for Pricing
View Details
Polyclonal Antibody to F-Box And WD Repeat Domain Containing Protein 7 (FBXW7)
MBS2026101-04 1 mL

Polyclonal Antibody to F-Box And WD Repeat Domain Containing Protein 7 (FBXW7)

Sign In for Pricing
View Details