Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ASNSD1 upstream open reading frame protein (ASURF), Biotinylated

This Recombinant Human ASNSD1 upstream open reading frame protein (ASURF), Biotinylated spans the amino acid sequence from region 1-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASNSD1 upstream open reading frame protein; ASNSD1 small/short open reading frame-encoded polypeptide; ASNSD1-SEP; ASDURF

UniProt

L0R819

Expression Region

1-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIFFLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CYB5R3 Antibody [Alexa Fluor 647]
NBP3-06497AF647 0.1 mL

Rabbit Polyclonal CYB5R3 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
MSR1 Antibody - N-terminal region
ARP63579_P050-25UL 25 µL

MSR1 Antibody - N-terminal region

Sign In for Pricing
View Details
MAGED1 (NRAGE) discontinued
511299 100 µg

MAGED1 (NRAGE) discontinued

Sign In for Pricing
View Details
Laminin, alpha 2 (Laminin, alpha 2 (LAMA2, Laminin M Chain, LAMM, Laminin-4 alpha, Laminin-12 alpha, Merosin Heavy Chain) (FITC)
MBS6147963-01 0.1 mL

Laminin, alpha 2 (Laminin, alpha 2 (LAMA2, Laminin M Chain, LAMM, Laminin-4 alpha, Laminin-12 alpha, Merosin Heavy Chain) (FITC)

Sign In for Pricing
View Details
Laminin, alpha 2 (Laminin, alpha 2 (LAMA2, Laminin M Chain, LAMM, Laminin-4 alpha, Laminin-12 alpha, Merosin Heavy Chain) (FITC)
MBS6147963-02 5x 0.1 mL

Laminin, alpha 2 (Laminin, alpha 2 (LAMA2, Laminin M Chain, LAMM, Laminin-4 alpha, Laminin-12 alpha, Merosin Heavy Chain) (FITC)

Sign In for Pricing
View Details
DYDC2 Double Nickase Plasmid (h2)
sc-418469-NIC-2 20 µg

DYDC2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details