Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,5-Dihydro-1H-pyrazol-3-amine Hydrochloride
TRC-D217655-2.5G 2.5 g

4,5-Dihydro-1H-pyrazol-3-amine Hydrochloride

Sign In for Pricing
View Details
PDE5A Antibody
KC-219-01 50 μL

PDE5A Antibody

Sign In for Pricing
View Details
PDE5A Antibody
KC-219-02 100 µL

PDE5A Antibody

Sign In for Pricing
View Details
PDE5A Antibody
KC-219-03 1 mL

PDE5A Antibody

Sign In for Pricing
View Details
galectin 9 (LGALS9) Human Gene Knockout Kit (CRISPR)
KN210750LP 1 Kit

galectin 9 (LGALS9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 18 (DA7), CF568 conjugate, 0.1mg/mL
BNC680198-500 1x 500 µL

Cytokeratin 18 (DA7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details