Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TENM3 Rabbit pAb, PE-Cy7 conjugated
orb2864451 100 µL

TENM3 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
1700019A02Rik (NM_027070) Mouse Tagged ORF Clone Lentiviral Particle
MR214585L3V 200 µL

1700019A02Rik (NM_027070) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
4-Amino-3-bromonitrobenzene
sc-256673 1 g

4-Amino-3-bromonitrobenzene

Sign In for Pricing
View Details
ABI2 Recombinant Antibody, Cy5.5 Conjugated
bsm-62336R-Cy5.5 100 µL

ABI2 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Lrrc10 (NM_001108096) Rat Tagged ORF Clone
RR212732 10 µg

Lrrc10 (NM_001108096) Rat Tagged ORF Clone

Sign In for Pricing
View Details
DLX4 Antibody - N-terminal region : Biotin (ARP39812_P050-Biotin)
ARP39812_P050-Biotin 100 µL

DLX4 Antibody - N-terminal region : Biotin (ARP39812_P050-Biotin)

Sign In for Pricing
View Details